Loading...
Statistics
Advertisement

Ameasureoftheyard.com

Domain is redirected to: Themeasureofayard.com
Advertisement
Ameasureoftheyard.com is hosted in United States / Scottsdale . Ameasureoftheyard.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Html5, Iframe, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Ameasureoftheyard.com

Technology

Number of occurences: 3
  • Html
  • Html5
  • Iframe

Advertisement

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Ameasureoftheyard.com

Missing HTTPS protocol.

    Meta - Ameasureoftheyard.com

    Number of occurences: 0

    Server / Hosting

    • IP: 184.168.221.56
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns78.domaincontrol.com
    • ns77.domaincontrol.com
    • smtp.secureserver.net
    • mailstore1.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Cache-Control: max-age=900 Content-Length: 0 Content-Type: text/html Location: http://www.themeasureofayard.com Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Fri, 08 Apr 2016 23:42:55 GMT Age: 1 Connection: keep-alive HTTP/1.1 200 OK Cache-Control: no-cache Pragma: no-cache Content-Length: 303 Content-Type: text/html; charset=utf-8 Expires: -1 Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Fri, 08 Apr 2016 23:42:55 GMT Age: 1 Connection: keep-alive

    DNS

    host: ameasureoftheyard.com
    1. class: IN
    2. ttl: 3599
    3. type: A
    4. ip: 50.63.202.1
    host: ameasureoftheyard.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns78.domaincontrol.com
    host: ameasureoftheyard.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns77.domaincontrol.com
    host: ameasureoftheyard.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns77.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2013082701
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 600
    host: ameasureoftheyard.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net
    host: ameasureoftheyard.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.measureoftheyard.com, www.aomeasureoftheyard.com, www.omeasureoftheyard.com, www.apmeasureoftheyard.com, www.pmeasureoftheyard.com, www.a9measureoftheyard.com, www.9measureoftheyard.com, www.ameasureoftheyard.com, www.measureoftheyard.com, www.aimeasureoftheyard.com, www.imeasureoftheyard.com, www.aumeasureoftheyard.com, www.umeasureoftheyard.com, www.aeasureoftheyard.com, www.ampeasureoftheyard.com, www.apeasureoftheyard.com, www.amoeasureoftheyard.com, www.aoeasureoftheyard.com, www.amieasureoftheyard.com, www.aieasureoftheyard.com, www.amkeasureoftheyard.com, www.akeasureoftheyard.com, www.am.easureoftheyard.com, www.a.easureoftheyard.com, www.amueasureoftheyard.com, www.aueasureoftheyard.com, www.amjeasureoftheyard.com, www.ajeasureoftheyard.com, www.amneasureoftheyard.com, www.aneasureoftheyard.com, www.am-easureoftheyard.com, www.a-easureoftheyard.com, www.amasureoftheyard.com, www.amexasureoftheyard.com, www.amxasureoftheyard.com, www.amesasureoftheyard.com, www.amsasureoftheyard.com, www.amewasureoftheyard.com, www.amwasureoftheyard.com, www.amerasureoftheyard.com, www.amrasureoftheyard.com, www.amefasureoftheyard.com, www.amfasureoftheyard.com, www.amevasureoftheyard.com, www.amvasureoftheyard.com, www.amecasureoftheyard.com, www.amcasureoftheyard.com, www.ameqasureoftheyard.com, www.amqasureoftheyard.com, www.ameaasureoftheyard.com, www.amaasureoftheyard.com, www.ameyasureoftheyard.com, www.amyasureoftheyard.com, www.amesureoftheyard.com, www.ameaosureoftheyard.com, www.ameosureoftheyard.com, www.ameapsureoftheyard.com, www.amepsureoftheyard.com, www.amea9sureoftheyard.com, www.ame9sureoftheyard.com, www.ameasureoftheyard.com, www.amesureoftheyard.com, www.ameaisureoftheyard.com, www.ameisureoftheyard.com, www.ameausureoftheyard.com, www.ameusureoftheyard.com, www.ameaureoftheyard.com, www.ameaseureoftheyard.com, www.ameaeureoftheyard.com, www.ameaswureoftheyard.com, www.ameawureoftheyard.com, www.ameasdureoftheyard.com, www.ameadureoftheyard.com, www.ameasxureoftheyard.com, www.ameaxureoftheyard.com, www.ameasfureoftheyard.com, www.ameafureoftheyard.com, www.ameasgureoftheyard.com, www.ameagureoftheyard.com, www.ameastureoftheyard.com, www.ameatureoftheyard.com, www.ameasreoftheyard.com, www.ameasuwreoftheyard.com, www.ameaswreoftheyard.com, www.ameasuereoftheyard.com, www.ameasereoftheyard.com, www.ameasusreoftheyard.com, www.ameassreoftheyard.com, www.ameasuareoftheyard.com, www.ameasareoftheyard.com, www.ameasueoftheyard.com, www.ameasurieoftheyard.com, www.ameasuieoftheyard.com, www.ameasuroeoftheyard.com, www.ameasuoeoftheyard.com, www.ameasurleoftheyard.com, www.ameasuleoftheyard.com, www.ameasurleoftheyard.com, www.ameasuleoftheyard.com, www.ameasur.eoftheyard.com, www.ameasu.eoftheyard.com, www.ameasuroftheyard.com, www.ameasurexoftheyard.com, www.ameasurxoftheyard.com, www.ameasuresoftheyard.com, www.ameasursoftheyard.com, www.ameasurewoftheyard.com, www.ameasurwoftheyard.com, www.ameasureroftheyard.com, www.ameasurroftheyard.com, www.ameasurefoftheyard.com, www.ameasurfoftheyard.com, www.ameasurevoftheyard.com, www.ameasurvoftheyard.com, www.ameasurecoftheyard.com, www.ameasurcoftheyard.com, www.ameasureqoftheyard.com, www.ameasurqoftheyard.com, www.ameasureaoftheyard.com, www.ameasuraoftheyard.com, www.ameasureyoftheyard.com, www.ameasuryoftheyard.com, www.ameasureftheyard.com, www.ameasureobftheyard.com, www.ameasurebftheyard.com, www.ameasureohftheyard.com, www.ameasurehftheyard.com, www.ameasureogftheyard.com, www.ameasuregftheyard.com, www.ameasureojftheyard.com, www.ameasurejftheyard.com, www.ameasureomftheyard.com, www.ameasuremftheyard.com, www.ameasureo ftheyard.com, www.ameasure ftheyard.com, www.ameasureovftheyard.com, www.ameasurevftheyard.com, www.ameasureotheyard.com, www.ameasureofqtheyard.com, www.ameasureoqtheyard.com, www.ameasureoftheyard.com, www.ameasureotheyard.com, www.ameasureofatheyard.com, www.ameasureoatheyard.com, www.ameasureofytheyard.com, www.ameasureoytheyard.com, www.ameasureofttheyard.com, www.ameasureottheyard.com, www.ameasureofgtheyard.com, www.ameasureogtheyard.com, www.ameasureofbtheyard.com, www.ameasureobtheyard.com, www.ameasureofwtheyard.com, www.ameasureowtheyard.com, www.ameasureofstheyard.com, www.ameasureostheyard.com, www.ameasureofdtheyard.com, www.ameasureodtheyard.com, www.ameasureofrtheyard.com, www.ameasureortheyard.com, www.ameasureof3theyard.com, www.ameasureo3theyard.com, www.ameasureof4theyard.com, www.ameasureo4theyard.com,

    Other websites we recently analyzed

    1. Hoedown Time
      Line dancing
      United States - 75.98.17.66
      Server software: Webs.com/1.0
      Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, Google Analytics
      Number of Javascript: 6
      Number of meta tags: 5
    2. avalonspb.ru - Diese Website steht zum Verkauf! - Informationen zum Thema webarchiv.
      Diese Website steht zum Verkauf! avalonspb.ru ist die beste Quelle für alle Informationen die Sie suchen. Von allgemeinen Themen bis hin zu speziellen Sachverhalten, finden Sie auf avalonspb.ru alles. Wir hoffen, dass Sie hier das Gesuchte finden!
      Germany - 82.98.86.164
      Server software: Apache/2.2.22 (Debian)
      Technology: Google Adsense, CSS, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 4
      Number of meta tags: 5
    3. DrinK.TeaM
      Team de poivrons - Have a drink
      France - 91.121.119.173
      Server software: Apache
      Technology: Html, Iframe, Javascript, Php, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 5
    4. media-magnat.com
      Ukraine - 91.200.40.52
      Server software: nginx/1.2.1
      Technology: Html
    5. sriswamisamarthvishwakalyankendra.org
      Santa Ana (United States) - 107.6.45.89
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 8
      Number of meta tags: 2
    6. Home
      Germany - 82.165.217.52
      Server software: Apache
      Technology: CSS, Html, Html5, Iframe, Javascript, Php, Facebook Box, Twitter Button
      Number of Javascript: 2
      Number of meta tags: 2
    7. Welcome to buahkaleng.com
      Welcome to buahkaleng.com
      Miami (United States) - 104.238.136.38
      Server software: nginx
      Technology: Google Adsense, Javascript, Php
      Number of Javascript: 5
      Number of meta tags: 4
    8. Финансовый портал – кредиты, ипотека, кредитные карты
      Финансовый портал – кредиты, ипотека, кредитные карты
      Russian Federation - 80.78.250.26
      Server software: nginx
      Technology: CSS, Google Font API, Html, Javascript, jQuery, MooTools, Php, Yandex.Metrika, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 4
    9. huyan.com
      New York (United States) - 69.172.201.208
      Server software: DOSarrest
      Technology: Html, Javascript
      Number of meta tags: 1
    10. Home - Aeka Biochemicals Pvt. Ltd.
      Orlando (United States) - 184.171.254.44
      G Analytics ID: UA-53264454-1
      Server software: Apache
      Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, Lightbox, Php, Pingback, Google Analytics, Wordpress, Facebook Box
      Number of Javascript: 15
      Number of meta tags: 5

    Check Other Websites